PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla019003
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family NF-YB
Protein Properties Length: 136aa    MW: 15407.3 Da    PI: 4.3129
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla019003genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB67.72.2e-212791491
      NF-YB 14 srimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91
               ++i+k++lP + ++++da++++ ec +efi +v+se+++ c +e+++ti+++ +l al  lGf +y+e++ +  +++r
  Cla019003  2 TKIIKEMLPPDVRVARDAQDLLIECCVEFINLVSSESNEVCSKEEKRTIAPEHVLKALEVLGFSEYIEEVYAAYEQHR 79
               68******************************************************************9977666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.8E-342121IPR009072Histone-fold
SuperFamilySSF471133.19E-312122IPR009072Histone-fold
PfamPF008081.5E-18259IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 136 aa     Download sequence    Send to blast
MTKIIKEMLP PDVRVARDAQ DLLIECCVEF INLVSSESNE VCSKEEKRTI APEHVLKALE  60
VLGFSEYIEE VYAAYEQHRL ETMQDSLKGG KWSNGAEMTE EEALAEQQRM FAEARARMNG  120
SNTAPKQPEP EQSLES
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B2e-30111521133Transcription Regulator NC2 beta chain
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818131e-68LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030.
GenBankLN7132561e-68LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008453352.11e-96PREDICTED: protein Dr1 homolog isoform X2
SwissprotP495923e-77NC2B_ARATH; Protein Dr1 homolog
TrEMBLA0A0A0LPP99e-95A0A0A0LPP9_CUCSA; Uncharacterized protein
STRINGGLYMA05G07750.19e-85(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47663358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.22e-78nuclear factor Y, subunit B13